SCOPe 2.08: Domain d1sejc1: 1sej C:3-180

Lineage for d1sejc1 (1sej C:3-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)

7. Species Cryptosporidium hominis [TaxId:237895] [102636] (15 PDB entries)
   Uniprot Q5CGA3 Q27552

8. Domain d1sejc1: 1sej C:3-180 [105459]
   Other proteins in same PDB: d1seja2, d1sejb2, d1sejc2, d1sejd2, d1seje2
   complexed with f89, ndp, ump

Details for d1sejc1

PDB Entry: 1sej, 2.87 Å

PDB Description: crystal structure of dihydrofolate reductase-thymidylate synthase from cryptosporidium hominis bound to 1843u89/nadph/dump

PDB Compounds: (C:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1sejc1:

Sequence; same for both SEQRES and ATOM records:

>d1sejc1 c.71.1.1 (C:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

Timeline for d1sejc1:

• d1sejc1 first appeared in SCOP 1.69
  
• d1sejc1 appears in SCOPe 2.07