SCOPe 2.07: Domain d1rz4a2: 1rz4 A:2-131

Lineage for d1rz4a2 (1rz4 A:2-131)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (10 families)

5. Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins)
   N-terminal part of Pfam PF06272
   Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
   Probably homologous to TPR rather than HEAT, based on PubMed 15790418
   this is a repeat family; one repeat unit is 4cr2 O:123-163 found in domain

6. Protein Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain [346010] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [346153] (1 PDB entry)
   Uniprot Q9UBQ5

8. Domain d1rz4a2: 1rz4 A:2-131 [105132]
   Other proteins in same PDB: d1rz4a1
   complexed with so4

Details for d1rz4a2

PDB Entry: 1rz4, 2.1 Å

PDB Description: Crystal Structure of Human eIF3k

PDB Compounds: (A:) Eukaryotic translation initiation factor 3 subunit 11

SCOPe Domain Sequences for d1rz4a2:

Sequence; same for both SEQRES and ATOM records:

>d1rz4a2 a.118.8.9 (A:2-131) Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
amfeqmranvgkllkgidrynpenlatleryvetqakenaydleanlavlklyqfnpaff
qttvtaqillkaltnlphtdftlckcmidqahqeerpirqilylgdlletchfqafwqal
denmdllegi

Timeline for d1rz4a2:

• d1rz4a2 first appeared in SCOP 1.69
  
• d1rz4a2 appears in SCOPe 2.06
  
• d1rz4a2 appears in the current release, SCOPe 2.08