Lineage for d1rz4a2 (1rz4 A:2-131)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2010109Family a.118.1.18: Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain [109968] (1 protein)
    N-terminal part of Pfam PF06272
  6. 2010110Protein Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain [109969] (1 species)
  7. 2010111Species Human (Homo sapiens) [TaxId:9606] [109970] (1 PDB entry)
    Uniprot Q9UBQ5
  8. 2010112Domain d1rz4a2: 1rz4 A:2-131 [105132]
    Other proteins in same PDB: d1rz4a1
    complexed with so4

Details for d1rz4a2

PDB Entry: 1rz4 (more details), 2.1 Å

PDB Description: Crystal Structure of Human eIF3k
PDB Compounds: (A:) Eukaryotic translation initiation factor 3 subunit 11

SCOPe Domain Sequences for d1rz4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz4a2 a.118.1.18 (A:2-131) Eukaryotic translation initiation factor 3 subunit 12, eIF3k, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
amfeqmranvgkllkgidrynpenlatleryvetqakenaydleanlavlklyqfnpaff
qttvtaqillkaltnlphtdftlckcmidqahqeerpirqilylgdlletchfqafwqal
denmdllegi

SCOPe Domain Coordinates for d1rz4a2:

Click to download the PDB-style file with coordinates for d1rz4a2.
(The format of our PDB-style files is described here.)

Timeline for d1rz4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rz4a1