Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries) Uniprot P33120 |
Domain d1p92a1: 1p92 A:1-64 [104085] Other proteins in same PDB: d1p92a2, d1p92a3 complexed with bme |
PDB Entry: 1p92 (more details), 2.1 Å
SCOPe Domain Sequences for d1p92a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p92a1 a.4.5.24 (A:1-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr slqm
Timeline for d1p92a1: