Lineage for d1p92a3 (1p92 A:148-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782726Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 2782792Family b.34.1.2: FeoA-like [50041] (5 proteins)
  6. 2782793Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 2782794Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
    Uniprot P33120
  8. 2782801Domain d1p92a3: 1p92 A:148-226 [104087]
    Other proteins in same PDB: d1p92a1, d1p92a2
    complexed with bme

Details for d1p92a3

PDB Entry: 1p92 (more details), 2.1 Å

PDB Description: crystal structure of (h79a)dtxr
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1p92a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p92a3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel

SCOPe Domain Coordinates for d1p92a3:

Click to download the PDB-style file with coordinates for d1p92a3.
(The format of our PDB-style files is described here.)

Timeline for d1p92a3: