PDB entry 1p92

View 1p92 on RCSB PDB site
Description: Crystal Structure of (H79A)DtxR
Class: DNA binding protein
Keywords: Diphtheria toxin repressor, DtxR, DNA-binding protein, Helix-turn-helix, SH3-like, metal ion binding site, DNA BINDING PROTEIN
Deposited on 2003-05-08, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.243
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120 (0-225)
      • engineered (78)
    Domains in SCOPe 2.07: d1p92a1, d1p92a2, d1p92a3
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p92A (A:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkarlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p92A (A:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkarlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgpgtrvidaatsmprkvrivqineifqvetdqftqlldadir
    vgseveivdrdghitlshngkdvellddlahtirieel