Lineage for d1v8ca2 (1v8c A:88-165)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2976197Superfamily d.129.5: MoaD-related protein, C-terminal domain [103239] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF09189
  5. 2976198Family d.129.5.1: MoaD-related protein, C-terminal domain [103240] (1 protein)
  6. 2976199Protein MoaD-related protein, C-terminal domain [103241] (1 species)
  7. 2976200Species Thermus thermophilus [TaxId:274] [103242] (1 PDB entry)
  8. 2976201Domain d1v8ca2: 1v8c A:88-165 [100496]
    Other proteins in same PDB: d1v8ca1, d1v8cb1, d1v8cc1, d1v8cd1
    complexed with cl, edo

Details for d1v8ca2

PDB Entry: 1v8c (more details), 1.6 Å

PDB Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8
PDB Compounds: (A:) MoaD related protein

SCOPe Domain Sequences for d1v8ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8ca2 d.129.5.1 (A:88-165) MoaD-related protein, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gfertfgafppwlleryleewggtregegvyrlpgavvrfreveplkvgslsipqlrvev
egeeaerwferiafaasr

SCOPe Domain Coordinates for d1v8ca2:

Click to download the PDB-style file with coordinates for d1v8ca2.
(The format of our PDB-style files is described here.)

Timeline for d1v8ca2: