| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.3: MoaD/ThiS [54285] (5 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
| Family d.15.3.1: MoaD [54286] (2 proteins) automatically mapped to Pfam PF02597 |
| Protein MoaD-related protein, N-terminal domain [102794] (1 species) |
| Species Thermus thermophilus [TaxId:274] [102795] (1 PDB entry) |
| Domain d1v8cc1: 1v8c C:1-87 [100499] Other proteins in same PDB: d1v8ca2, d1v8cb2, d1v8cc2, d1v8cd2 complexed with cl, edo |
PDB Entry: 1v8c (more details), 1.6 Å
SCOPe Domain Sequences for d1v8cc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8cc1 d.15.3.1 (C:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
dvrylqglstplspgatldlfppvagg
Timeline for d1v8cc1: