Lineage for d1v8cd1 (1v8c D:1-87)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. Family d.15.3.1: MoaD [54286] (2 proteins)
    automatically mapped to Pfam PF02597
  6. Protein MoaD-related protein, N-terminal domain [102794] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [102795] (1 PDB entry)
  8. Domain d1v8cd1: 1v8c D:1-87 [100501]
    Other proteins in same PDB: d1v8ca2, d1v8cb2, d1v8cc2, d1v8cd2
    complexed with cl, edo

Details for d1v8cd1

PDB Entry: 1v8c (more details), 1.6 Å

PDB Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8
PDB Compounds: (D:) MoaD related protein

SCOPe Domain Sequences for d1v8cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8cd1 d.15.3.1 (D:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
dvrylqglstplspgatldlfppvagg

SCOPe Domain Coordinates for d1v8cd1 are not available.

Timeline for d1v8cd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v8cd2
View in 3D
Domains from other chains:
(mouse over for more information)
d1v8ca1, d1v8ca2, d1v8cb1, d1v8cb2, d1v8cc1, d1v8cc2