Lineage for d1v8cb1 (1v8c B:1-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933706Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 2933707Family d.15.3.1: MoaD [54286] (2 proteins)
    automatically mapped to Pfam PF02597
  6. 2933708Protein MoaD-related protein, N-terminal domain [102794] (1 species)
  7. 2933709Species Thermus thermophilus [TaxId:274] [102795] (1 PDB entry)
  8. 2933711Domain d1v8cb1: 1v8c B:1-83 [100497]
    Other proteins in same PDB: d1v8ca2, d1v8cb2, d1v8cc2, d1v8cd2
    complexed with cl, edo

Details for d1v8cb1

PDB Entry: 1v8c (more details), 1.6 Å

PDB Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8
PDB Compounds: (B:) MoaD related protein

SCOPe Domain Sequences for d1v8cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8cb1 d.15.3.1 (B:1-83) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
dvrylqglstplspgatldlfpp

SCOPe Domain Coordinates for d1v8cb1:

Click to download the PDB-style file with coordinates for d1v8cb1.
(The format of our PDB-style files is described here.)

Timeline for d1v8cb1: