PDB entry 1v8c

View 1v8c on RCSB PDB site
Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8
Class: protein binding
Keywords: MoaD related protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PROTEIN BINDING
Deposited on 2004-01-05, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.221
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MoaD related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8ca1, d1v8ca2
  • Chain 'B':
    Compound: MoaD related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8cb1, d1v8cb2
  • Chain 'C':
    Compound: MoaD related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8cc1, d1v8cc2
  • Chain 'D':
    Compound: MoaD related protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8cd1, d1v8cd2
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8cA (A:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasrggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8cA (A:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8cB (B:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasrggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8cB (B:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppgfertfgafppwlleryleewggtregegvyrlpgav
    vrfreveplkvgslsipqlrvevegeeaerwferiafaas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8cC (C:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasrggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8cC (C:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v8cD (D:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasrggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8cD (D:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasr