Lineage for d1v8cd2 (1v8c D:88-165)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. Superfamily d.129.5: MoaD-related protein, C-terminal domain [103239] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF09189
  5. Family d.129.5.1: MoaD-related protein, C-terminal domain [103240] (1 protein)
  6. Protein MoaD-related protein, C-terminal domain [103241] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [103242] (1 PDB entry)
  8. Domain d1v8cd2: 1v8c D:88-165 [100502]
    Other proteins in same PDB: d1v8ca1, d1v8cb1, d1v8cc1, d1v8cd1
    complexed with cl, edo

Details for d1v8cd2

PDB Entry: 1v8c (more details), 1.6 Å

PDB Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8
PDB Compounds: (D:) MoaD related protein

SCOPe Domain Sequences for d1v8cd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8cd2 d.129.5.1 (D:88-165) MoaD-related protein, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gfertfgafppwlleryleewggtregegvyrlpgavvrfreveplkvgslsipqlrvev
egeeaerwferiafaasr

SCOPe Domain Coordinates for d1v8cd2 are not available.

Timeline for d1v8cd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v8cd1
View in 3D
Domains from other chains:
(mouse over for more information)
d1v8ca1, d1v8ca2, d1v8cb1, d1v8cb2, d1v8cc1, d1v8cc2