Lineage for d1uzjb2 (1uzj B:2605-2647)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031474Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 3031475Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries)
  8. 3031483Domain d1uzjb2: 1uzj B:2605-2647 [100227]
    Other proteins in same PDB: d1uzja3, d1uzjb3, d1uzjc3
    CBEGF22 and CBEGF23
    complexed with ca

Details for d1uzjb2

PDB Entry: 1uzj (more details), 2.25 Å

PDB Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, holo form.
PDB Compounds: (B:) fibrillin-1

SCOPe Domain Sequences for d1uzjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzjb2 g.3.11.1 (B:2605-2647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}
edidecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd

SCOPe Domain Coordinates for d1uzjb2:

Click to download the PDB-style file with coordinates for d1uzjb2.
(The format of our PDB-style files is described here.)

Timeline for d1uzjb2: