Lineage for d1uzjc3 (1uzj C:3529-3604)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034636Fold g.23: TB module/8-cys domain [57580] (1 superfamily)
    disulfide-rich; alpha+beta
  4. 3034637Superfamily g.23.1: TB module/8-cys domain [57581] (1 family) (S)
  5. 3034638Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins)
    transforming growth factor beta binding protein-like domain
  6. 3034639Protein Fibrillin [57583] (1 species)
  7. 3034640Species Human (Homo sapiens) [TaxId:9606] [57584] (5 PDB entries)
  8. 3034645Domain d1uzjc3: 1uzj C:3529-3604 [100231]
    Other proteins in same PDB: d1uzja1, d1uzja2, d1uzjb1, d1uzjb2, d1uzjc1, d1uzjc2
    TB4
    complexed with ca

Details for d1uzjc3

PDB Entry: 1uzj (more details), 2.25 Å

PDB Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, holo form.
PDB Compounds: (C:) fibrillin-1

SCOPe Domain Sequences for d1uzjc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzjc3 g.23.1.1 (C:3529-3604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]}
trsgncyldirprgdngdtacsneigvgvskascccslgkawgtpcemcpavntseykil
cpggegfrpnpitvil

SCOPe Domain Coordinates for d1uzjc3:

Click to download the PDB-style file with coordinates for d1uzjc3.
(The format of our PDB-style files is described here.)

Timeline for d1uzjc3: