PDB entry 1uzj

View 1uzj on RCSB PDB site
Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, holo form.
Class: matrix protein
Keywords: matrix protein, extra-cellular matrix, fibrillin-1, cbegf domain, tb domain matrix protein
Deposited on 2004-03-12, released 2004-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.247
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzja1, d1uzja2, d1uzja3
  • Chain 'B':
    Compound: fibrillin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzjb1, d1uzjb2, d1uzjb3
  • Chain 'C':
    Compound: fibrillin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzjc1, d1uzjc2, d1uzjc3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzjA (A:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
    dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
    didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzjB (B:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
    dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
    didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzjC (C:)
    tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
    dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
    didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd