Lineage for d4p8qa1 (4p8q A:159-366)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820704Domain d4p8qa1: 4p8q A:159-366 [261381]
    Other proteins in same PDB: d4p8qa2, d4p8qa3, d4p8qa4, d4p8qb2, d4p8qb3, d4p8qb4
    automated match to d3se6a1
    complexed with nag, unl, zn

Details for d4p8qa1

PDB Entry: 4p8q (more details), 3.02 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with alanine in active site
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4p8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p8qa1 b.98.1.0 (A:159-366) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisr
vtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfs
ytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvv
lddglvqdefsesvkmstylvafivgem

SCOPe Domain Coordinates for d4p8qa1:

Click to download the PDB-style file with coordinates for d4p8qa1.
(The format of our PDB-style files is described here.)

Timeline for d4p8qa1: