Lineage for d4p8qb4 (4p8q B:707-1025)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726173Domain d4p8qb4: 4p8q B:707-1025 [263459]
    Other proteins in same PDB: d4p8qa1, d4p8qa2, d4p8qa3, d4p8qb1, d4p8qb2, d4p8qb3
    automated match to d4p8qa4
    complexed with nag, unl, zn

Details for d4p8qb4

PDB Entry: 4p8q (more details), 3.02 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with alanine in active site
PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4p8qb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p8qb4 a.118.1.0 (B:707-1025) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapit
ealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsallef
acthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisigs
eaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfvk
enwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqealev
iqlniqwmeknlksltwwl

SCOPe Domain Coordinates for d4p8qb4:

Click to download the PDB-style file with coordinates for d4p8qb4.
(The format of our PDB-style files is described here.)

Timeline for d4p8qb4: