Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) |
Domain d4p8qb2: 4p8q B:367-615 [263457] Other proteins in same PDB: d4p8qa1, d4p8qa3, d4p8qa4, d4p8qb1, d4p8qb3, d4p8qb4 automated match to d4p8qa2 complexed with nag, unl, zn |
PDB Entry: 4p8q (more details), 3.02 Å
SCOPe Domain Sequences for d4p8qb2:
Sequence, based on SEQRES records: (download)
>d4p8qb2 d.92.1.0 (B:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]} knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm mktwtlqkg
>d4p8qb2 d.92.1.0 (B:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]} knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevnqtldvkrmm ktwtlqkg
Timeline for d4p8qb2:
View in 3D Domains from other chains: (mouse over for more information) d4p8qa1, d4p8qa2, d4p8qa3, d4p8qa4 |