Lineage for d4p8qa3 (4p8q A:616-706)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2766997Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2767034Domain d4p8qa3: 4p8q A:616-706 [261383]
    Other proteins in same PDB: d4p8qa1, d4p8qa2, d4p8qa4, d4p8qb1, d4p8qb2, d4p8qb4
    automated match to d3se6b3
    complexed with nag, unl, zn

Details for d4p8qa3

PDB Entry: 4p8q (more details), 3.02 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with alanine in active site
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4p8qa3:

Sequence, based on SEQRES records: (download)

>d4p8qa3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld
kksgvinlteevlwvkvninmngyyivhyad

Sequence, based on observed residues (ATOM records): (download)

>d4p8qa3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmsdtsylwhiplsyvtegrnyskyqsvslldkksgvi
nlteevlwvkvninmngyyivhyad

SCOPe Domain Coordinates for d4p8qa3:

Click to download the PDB-style file with coordinates for d4p8qa3.
(The format of our PDB-style files is described here.)

Timeline for d4p8qa3: