![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
![]() | Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
![]() | Protein automated matches [254707] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
![]() | Domain d4p8qa3: 4p8q A:616-706 [261383] Other proteins in same PDB: d4p8qa1, d4p8qa2, d4p8qa4, d4p8qb1, d4p8qb2, d4p8qb4 automated match to d3se6b3 complexed with nag, unl, zn |
PDB Entry: 4p8q (more details), 3.02 Å
SCOPe Domain Sequences for d4p8qa3:
Sequence, based on SEQRES records: (download)
>d4p8qa3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld kksgvinlteevlwvkvninmngyyivhyad
>d4p8qa3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplvtvqkkgkelfiqqerfflnmsdtsylwhiplsyvtegrnyskyqsvslldkksgvi nlteevlwvkvninmngyyivhyad
Timeline for d4p8qa3:
![]() Domains from other chains: (mouse over for more information) d4p8qb1, d4p8qb2, d4p8qb3, d4p8qb4 |