Class b: All beta proteins [48724] (178 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
Domain d4p8qa1: 4p8q A:159-366 [261381] Other proteins in same PDB: d4p8qa2, d4p8qa3, d4p8qa4, d4p8qb2, d4p8qb3, d4p8qb4 automated match to d3se6a1 complexed with nag, unl, zn |
PDB Entry: 4p8q (more details), 3.02 Å
SCOPe Domain Sequences for d4p8qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p8qa1 b.98.1.0 (A:159-366) automated matches {Human (Homo sapiens) [TaxId: 9606]} klfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisr vtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfs ytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvv lddglvqdefsesvkmstylvafivgem
Timeline for d4p8qa1:
View in 3D Domains from other chains: (mouse over for more information) d4p8qb1, d4p8qb2, d4p8qb3, d4p8qb4 |