Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
Protein automated matches [190463] (9 species) not a true protein |
Species Lactococcus lactis [TaxId:1359] [256615] (1 PDB entry) |
Domain d4cisa3: 4cis A:219-271 [256616] Other proteins in same PDB: d4cisa1, d4cisa2, d4cisb1, d4cisb2 automated match to d1xc8a3 protein/DNA complex; complexed with bu3, zn |
PDB Entry: 4cis (more details), 2.05 Å
SCOPe Domain Sequences for d4cisa3:
Sequence, based on SEQRES records: (download)
>d4cisa3 g.39.1.0 (A:219-271) automated matches {Lactococcus lactis [TaxId: 1359]} irtysalgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpfcqqk
>d4cisa3 g.39.1.0 (A:219-271) automated matches {Lactococcus lactis [TaxId: 1359]} itgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpfcqqk
Timeline for d4cisa3: