| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
| Family a.156.1.0: automated matches [254300] (1 protein) not a true family |
| Protein automated matches [254693] (4 species) not a true protein |
| Species Lactococcus lactis [TaxId:1359] [256613] (1 PDB entry) |
| Domain d4cisb2: 4cis B:132-218 [258648] Other proteins in same PDB: d4cisa1, d4cisa3, d4cisb1, d4cisb3 automated match to d1pjia1 protein/DNA complex; complexed with bu3, zn |
PDB Entry: 4cis (more details), 2.05 Å
SCOPe Domain Sequences for d4cisb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cisb2 a.156.1.0 (B:132-218) automated matches {Lactococcus lactis [TaxId: 1359]}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpekeanq
liessihllhdsiieilqkaiklggss
Timeline for d4cisb2: