Lineage for d4cisb2 (4cis B:132-218)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735452Family a.156.1.0: automated matches [254300] (1 protein)
    not a true family
  6. 2735453Protein automated matches [254693] (4 species)
    not a true protein
  7. 2735459Species Lactococcus lactis [TaxId:1359] [256613] (1 PDB entry)
  8. 2735461Domain d4cisb2: 4cis B:132-218 [258648]
    Other proteins in same PDB: d4cisa1, d4cisa3, d4cisb1, d4cisb3
    automated match to d1pjia1
    protein/DNA complex; complexed with bu3, zn

Details for d4cisb2

PDB Entry: 4cis (more details), 2.05 Å

PDB Description: structure of mutm in complex with carbocyclic 8-oxo-g containing dna
PDB Compounds: (B:) formamidopyrimidin DNA glycosylase

SCOPe Domain Sequences for d4cisb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cisb2 a.156.1.0 (B:132-218) automated matches {Lactococcus lactis [TaxId: 1359]}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpekeanq
liessihllhdsiieilqkaiklggss

SCOPe Domain Coordinates for d4cisb2:

Click to download the PDB-style file with coordinates for d4cisb2.
(The format of our PDB-style files is described here.)

Timeline for d4cisb2: