![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) ![]() automatically mapped to Pfam PF01149 |
![]() | Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins) |
![]() | Protein automated matches [254692] (3 species) not a true protein |
![]() | Species Lactococcus lactis [TaxId:1359] [256611] (1 PDB entry) |
![]() | Domain d4cisa1: 4cis A:1-131 [256612] Other proteins in same PDB: d4cisa2, d4cisa3, d4cisb2, d4cisb3 automated match to d1xc8a2 protein/DNA complex; complexed with bu3, zn |
PDB Entry: 4cis (more details), 2.05 Å
SCOPe Domain Sequences for d4cisa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cisa1 b.113.1.1 (A:1-131) automated matches {Lactococcus lactis [TaxId: 1359]} pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgkiiqgiirrgkyli feigddfrlishlrmegkyrlatldaprekhdhltmkfsdgqliyadvrkfgtwelistd qvlpyflnkki
Timeline for d4cisa1: