SCOPe 2.08: Domain d4cisa1: 4cis A:1-131

Lineage for d4cisa1 (4cis A:1-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families)
   automatically mapped to Pfam PF01149

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)

6. Protein automated matches [254692] (3 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1359] [256611] (1 PDB entry)

8. Domain d4cisa1: 4cis A:1-131 [256612]
   Other proteins in same PDB: d4cisa2, d4cisa3, d4cisb2, d4cisb3
   automated match to d1xc8a2
   protein/DNA complex; complexed with bu3, zn

Details for d4cisa1

PDB Entry: 4cis, 2.05 Å

PDB Description: structure of mutm in complex with carbocyclic 8-oxo-g containing dna

PDB Compounds: (A:) formamidopyrimidin DNA glycosylase

SCOPe Domain Sequences for d4cisa1:

Sequence; same for both SEQRES and ATOM records:

>d4cisa1 b.113.1.1 (A:1-131) automated matches {Lactococcus lactis [TaxId: 1359]}
pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgkiiqgiirrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfsdgqliyadvrkfgtwelistd
qvlpyflnkki

Timeline for d4cisa1:

• d4cisa1 first appeared in SCOPe 2.04
  
• d4cisa1 appears in SCOPe 2.07