| Class g: Small proteins [56992] (100 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
| Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
| Protein automated matches [190463] (9 species) not a true protein |
| Species Lactococcus lactis [TaxId:1359] [256615] (1 PDB entry) |
| Domain d4cisb3: 4cis B:219-271 [258653] Other proteins in same PDB: d4cisa1, d4cisa2, d4cisb1, d4cisb2 automated match to d1xc8a3 protein/DNA complex; complexed with bu3, zn |
PDB Entry: 4cis (more details), 2.05 Å
SCOPe Domain Sequences for d4cisb3:
Sequence, based on SEQRES records: (download)
>d4cisb3 g.39.1.0 (B:219-271) automated matches {Lactococcus lactis [TaxId: 1359]}
irtysalgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpfcqqk
>d4cisb3 g.39.1.0 (B:219-271) automated matches {Lactococcus lactis [TaxId: 1359]}
irlgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpfcqqk
Timeline for d4cisb3: