Lineage for d3hujc1 (3huj C:5-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937558Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)
  8. 2937565Domain d3hujc1: 3huj C:5-183 [199526]
    Other proteins in same PDB: d3huja2, d3huja3, d3hujb_, d3hujc2, d3hujc3, d3hujd_, d3huje1, d3huje2, d3hujf1, d3hujf2, d3hujg1, d3hujg2, d3hujh1, d3hujh2
    automated match to d1onqa2
    complexed with agh, mg, nag

Details for d3hujc1

PDB Entry: 3huj (more details), 2.5 Å

PDB Description: crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
PDB Compounds: (C:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d3hujc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hujc1 d.19.1.1 (C:5-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
qrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwe
tlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdil
sfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d3hujc1:

Click to download the PDB-style file with coordinates for d3hujc1.
(The format of our PDB-style files is described here.)

Timeline for d3hujc1: