Lineage for d2xyfa_ (2xyf A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrel
Protein automated matches [190433] (12 species)
not a true protein
Species Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId:11683] [189840] (10 PDB entries) 
Domain d2xyfa_: 2xyf A: [170480]
automated match to d1k6ca_
complexed with g40
Details for d2xyfa_
PDB Entry: 2xyf (more details), 1.8 Å
PDB Description: hiv-1 inhibitors with a tertiary-alcohol-containing transition-state mimic and various p2 and p1 prime substituents
PDB Compounds: (A:) ProteaseSCOPe Domain Sequences for d2xyfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xyfa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId: 11683]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf
SCOPe Domain Coordinates for d2xyfa_:
Click to download the PDB-style file with coordinates for d2xyfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xyfa_:
- d2xyfa_ first appeared in SCOPe 2.01
- d2xyfa_ appears in SCOPe 2.06
- d2xyfa_ appears in the current release, SCOPe 2.08
View in 3D
