Lineage for d2xyfa_ (2xyf A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392314Protein automated matches [190433] (11 species)
    not a true protein
  7. 2392337Species Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId:11683] [189840] (10 PDB entries)
  8. 2392348Domain d2xyfa_: 2xyf A: [170480]
    automated match to d1k6ca_
    complexed with g40

Details for d2xyfa_

PDB Entry: 2xyf (more details), 1.8 Å

PDB Description: hiv-1 inhibitors with a tertiary-alcohol-containing transition-state mimic and various p2 and p1 prime substituents
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2xyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xyfa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId: 11683]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOPe Domain Coordinates for d2xyfa_:

Click to download the PDB-style file with coordinates for d2xyfa_.
(The format of our PDB-style files is described here.)

Timeline for d2xyfa_: