SCOPe 2.07: Domain d2xyfb_: 2xyf B:

Lineage for d2xyfb_ (2xyf B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId:11683] [189840] (10 PDB entries)

8. Domain d2xyfb_: 2xyf B: [170481]
   automated match to d1k6ca_
   complexed with g40

Details for d2xyfb_

PDB Entry: 2xyf, 1.8 Å

PDB Description: hiv-1 inhibitors with a tertiary-alcohol-containing transition-state mimic and various p2 and p1 prime substituents

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d2xyfb_:

Sequence; same for both SEQRES and ATOM records:

>d2xyfb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId: 11683]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d2xyfb_:

• d2xyfb_ first appeared in SCOPe 2.01
  
• d2xyfb_ appears in SCOPe 2.06
  
• d2xyfb_ appears in the current release, SCOPe 2.08