![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
![]() | Superfamily a.280.1: RbcX-like [158615] (2 families) ![]() |
![]() | Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
![]() | Protein RuBisCo chaperone RbcX [158617] (5 species) |
![]() | Species Anabaena sp. [TaxId:1167] [158619] (2 PDB entries) Uniprot Q44212 1-115 |
![]() | Domain d2peoa1: 2peo A:1-115 [149441] |
PDB Entry: 2peo (more details), 2.5 Å
SCOPe Domain Sequences for d2peoa1:
Sequence, based on SEQRES records: (download)
>d2peoa1 a.280.1.1 (A:1-115) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]} mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh
>d2peoa1 a.280.1.1 (A:1-115) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]} mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh
Timeline for d2peoa1: