Lineage for d2peoa1 (2peo A:1-115)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351974Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2351975Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2351976Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 2351977Protein RuBisCo chaperone RbcX [158617] (5 species)
  7. 2351978Species Anabaena sp. [TaxId:1167] [158619] (2 PDB entries)
    Uniprot Q44212 1-115
  8. 2351981Domain d2peoa1: 2peo A:1-115 [149441]

Details for d2peoa1

PDB Entry: 2peo (more details), 2.5 Å

PDB Description: crystal structure of rbcx from anabaena ca
PDB Compounds: (A:) RbcX protein

SCOPe Domain Sequences for d2peoa1:

Sequence, based on SEQRES records: (download)

>d2peoa1 a.280.1.1 (A:1-115) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf
lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh

Sequence, based on observed residues (ATOM records): (download)

>d2peoa1 a.280.1.1 (A:1-115) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle
kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh

SCOPe Domain Coordinates for d2peoa1:

Click to download the PDB-style file with coordinates for d2peoa1.
(The format of our PDB-style files is described here.)

Timeline for d2peoa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2peob_