SCOPe 2.08: Domain d2peob_: 2peo B:

Lineage for d2peob_ (2peo B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (5 species)

7. Species Anabaena sp. [TaxId:1167] [158619] (2 PDB entries)
   Uniprot Q44212 1-115

8. Domain d2peob_: 2peo B: [149442]
   automated match to d2peoa1

Details for d2peob_

PDB Entry: 2peo, 2.5 Å

PDB Description: crystal structure of rbcx from anabaena ca

PDB Compounds: (B:) RbcX protein

SCOPe Domain Sequences for d2peob_:

Sequence, based on SEQRES records:

>d2peob_ a.280.1.1 (B:) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf
lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvsls

Sequence, based on observed residues (ATOM records):

>d2peob_ a.280.1.1 (B:) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle
kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvsls

Timeline for d2peob_:

• d2peob_ first appeared in SCOP 1.75, called d2peob1
  
• d2peob_ appears in SCOPe 2.07