Lineage for d2peoa1 (2peo A:1-115)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781293Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 781294Superfamily a.280.1: RbcX-like [158615] (1 family) (S)
  5. 781295Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 781296Protein RuBisCo chaperone RbcX [158617] (3 species)
  7. 781297Species Anabaena sp. [TaxId:1167] [158619] (1 PDB entry)
    Uniprot Q44212 1-115
  8. 781298Domain d2peoa1: 2peo A:1-115 [149441]

Details for d2peoa1

PDB Entry: 2peo (more details), 2.5 Å

PDB Description: crystal structure of rbcx from anabaena ca
PDB Compounds: (A:) RbcX protein

SCOP Domain Sequences for d2peoa1:

Sequence, based on SEQRES records: (download)

>d2peoa1 a.280.1.1 (A:1-115) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf
lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh

Sequence, based on observed residues (ATOM records): (download)

>d2peoa1 a.280.1.1 (A:1-115) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle
kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh

SCOP Domain Coordinates for d2peoa1:

Click to download the PDB-style file with coordinates for d2peoa1.
(The format of our PDB-style files is described here.)

Timeline for d2peoa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2peob1