PDB entry 2peo

View 2peo on RCSB PDB site
Description: Crystal structure of RbcX from Anabaena CA
Class: chaperone
Keywords: helix bundle, protein complex assembly, chaperone
Deposited on 2007-04-03, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RbcX protein
    Species: Anabaena sp. [TaxId:52271]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2peoa1
  • Chain 'B':
    Compound: RbcX protein
    Species: Anabaena sp. [TaxId:52271]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2peob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2peoA (A:)
    mgsshhhhhhssglvprgshmnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalw
    lhnfsagkvqdgekyieelflekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmek
    rrqhlermtqvslshpspeseqqqfsdpdwdnlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peoA (A:)
    mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle
    kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvslsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2peoB (B:)
    mgsshhhhhhssglvprgshmnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalw
    lhnfsagkvqdgekyieelflekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmek
    rrqhlermtqvslshpspeseqqqfsdpdwdnlas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peoB (B:)
    mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagqdgekyieelfle
    kpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhlermtqvsls