Lineage for d2h6ca1 (2h6c A:148-226)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693005Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2693062Protein Chlorophenol reduction protein CprK [158268] (2 species)
  7. 2693063Species Desulfitobacterium dehalogenans [TaxId:36854] [158269] (1 PDB entry)
    Uniprot Q9LAS2 148-226
  8. 2693064Domain d2h6ca1: 2h6c A:148-226 [147232]
    Other proteins in same PDB: d2h6ca2, d2h6cb2

Details for d2h6ca1

PDB Entry: 2h6c (more details), 2.9 Å

PDB Description: Crystal structure of reduced CprK in absence of any ligand
PDB Compounds: (A:) ChloroPhenol Reduction gene K

SCOPe Domain Sequences for d2h6ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6ca1 a.4.5.4 (A:148-226) Chlorophenol reduction protein CprK {Desulfitobacterium dehalogenans [TaxId: 36854]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgahhvtvskvlaclkkenil
dkkknkfivynleelkhls

SCOPe Domain Coordinates for d2h6ca1:

Click to download the PDB-style file with coordinates for d2h6ca1.
(The format of our PDB-style files is described here.)

Timeline for d2h6ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h6ca2