SCOPe 2.08: Domain d2h6cb1: 2h6c B:148-226

Lineage for d2h6cb1 (2h6c B:148-226)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Chlorophenol reduction protein CprK [158268] (2 species)

7. Species Desulfitobacterium dehalogenans [TaxId:36854] [158269] (1 PDB entry)
   Uniprot Q9LAS2 148-226

8. Domain d2h6cb1: 2h6c B:148-226 [147234]
   Other proteins in same PDB: d2h6ca2, d2h6cb2
   automated match to d2h6ca1

Details for d2h6cb1

PDB Entry: 2h6c, 2.9 Å

PDB Description: Crystal structure of reduced CprK in absence of any ligand

PDB Compounds: (B:) ChloroPhenol Reduction gene K

SCOPe Domain Sequences for d2h6cb1:

Sequence; same for both SEQRES and ATOM records:

>d2h6cb1 a.4.5.4 (B:148-226) Chlorophenol reduction protein CprK {Desulfitobacterium dehalogenans [TaxId: 36854]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgahhvtvskvlaclkkenil
dkkknkfivynleelkhls

Timeline for d2h6cb1:

• d2h6cb1 first appeared in SCOP 1.75
  
• d2h6cb1 appears in SCOPe 2.07