SCOPe 2.08: Domain d2h6ca2: 2h6c A:19-147

Lineage for d2h6ca2 (2h6c A:19-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Chlorophenol reduction protein CprK [159314] (2 species)

7. Species Desulfitobacterium dehalogenans [TaxId:36854] [159316] (1 PDB entry)
   Uniprot Q9LAS2 19-147

8. Domain d2h6ca2: 2h6c A:19-147 [147233]
   Other proteins in same PDB: d2h6ca1, d2h6cb1

Details for d2h6ca2

PDB Entry: 2h6c, 2.9 Å

PDB Description: Crystal structure of reduced CprK in absence of any ligand

PDB Compounds: (A:) ChloroPhenol Reduction gene K

SCOPe Domain Sequences for d2h6ca2:

Sequence; same for both SEQRES and ATOM records:

>d2h6ca2 b.82.3.2 (A:19-147) Chlorophenol reduction protein CprK {Desulfitobacterium dehalogenans [TaxId: 36854]}
ffpieklrnytdmgiirefakgsaiimpgedttsmiflmdgkikldiifedgsekllyya
gsnsligrlyptgnniyatameqtrtcwfseeclrvifrtdedmifeifknyltkvayya
rqvaeinty

Timeline for d2h6ca2:

• d2h6ca2 first appeared in SCOP 1.75
  
• d2h6ca2 appears in SCOPe 2.07