PDB entry 2h6c

View 2h6c on RCSB PDB site
Description: Crystal structure of reduced CprK in absence of any ligand
Class: DNA binding protein
Keywords: DNA binding, helix-turn-helix, chlorophenol, halorespiration, CprK, DNA BINDING PROTEIN
Deposited on 2006-05-31, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ChloroPhenol Reduction gene K
    Species: Desulfitobacterium dehalogenans [TaxId:36854]
    Gene: cprK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h6ca1, d2h6ca2
  • Chain 'B':
    Compound: ChloroPhenol Reduction gene K
    Species: Desulfitobacterium dehalogenans [TaxId:36854]
    Gene: cprK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h6cb1, d2h6cb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h6cA (A:)
    msaegldkdfcgaiipdsffpieklrnytdmgiirefakgsaiimpgedttsmiflmdgk
    ikldiifedgsekllyyagsnsligrlyptgnniyatameqtrtcwfseeclrvifrtde
    dmifeifknyltkvayyarqvaeintynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgahhvtvskvlaclkkenildkkknkfivynleelkhlseqtsyy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6cA (A:)
    ffpieklrnytdmgiirefakgsaiimpgedttsmiflmdgkikldiifedgsekllyya
    gsnsligrlyptgnniyatameqtrtcwfseeclrvifrtdedmifeifknyltkvayya
    rqvaeintynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgahhvtvskvl
    aclkkenildkkknkfivynleelkhls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h6cB (B:)
    msaegldkdfcgaiipdsffpieklrnytdmgiirefakgsaiimpgedttsmiflmdgk
    ikldiifedgsekllyyagsnsligrlyptgnniyatameqtrtcwfseeclrvifrtde
    dmifeifknyltkvayyarqvaeintynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgahhvtvskvlaclkkenildkkknkfivynleelkhlseqtsyy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h6cB (B:)
    ffpieklrnytdmgiirefakgsaiimpgedttsmiflmdgkikldiifedgsekllyya
    gsnsligrlyptgnniyatameqtrtcwfseeclrvifrtdedmifeifknyltkvayya
    rqvaeintynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgahhvtvskvl
    aclkkenildkkknkfivynleelkhls