SCOPe 2.08: Domain d2b8ta2: 2b8t A:150-216

Lineage for d2b8ta2 (2b8t A:150-216)

Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds)
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
alpha+beta metal(zinc)-bound fold
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)
Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
C-terminal part of Pfam PF00265
Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species)
Species Ureaplasma urealyticum [TaxId:2130] [118279] (3 PDB entries)
Uniprot Q9PPP5 11-211

Domain d2b8ta2: 2b8t A:150-216 [128110]
Other proteins in same PDB: d2b8ta1, d2b8tb1, d2b8tc1, d2b8td1
complexed with thm, trs, zn
has additional insertions and/or extensions that are not grouped together

Details for d2b8ta2

PDB Entry: 2b8t (more details), 2 Å

PDB Description: crystal structure of thymidine kinase from u.urealyticum in complex with thymidine

PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2b8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8ta2 g.39.1.14 (A:150-216) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee
fikffkn

SCOPe Domain Coordinates for d2b8ta2:

Click to download the PDB-style file with coordinates for d2b8ta2.
(The format of our PDB-style files is described here.)

Timeline for d2b8ta2: