Lineage for d1wvfa1 (1wvf A:243-521)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (6 families) 
duplication: contains two subdomains of this foldFamily d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
automatically mapped to Pfam PF02913Protein automated matches [254446] (1 species)
not a true proteinSpecies Pseudomonas putida [TaxId:303] [254951] (2 PDB entries) 
Domain d1wvfa1: 1wvf A:243-521 [121337]
Other proteins in same PDB: d1wvfa2
automated match to d1wvfa1
complexed with acy, cl, fad, gol
Details for d1wvfa1
PDB Entry: 1wvf (more details), 1.3 Å
PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (A:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunitSCOPe Domain Sequences for d1wvfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvfa1 d.58.32.1 (A:243-521) automated matches {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf
SCOPe Domain Coordinates for d1wvfa1:
Click to download the PDB-style file with coordinates for d1wvfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wvfa1:
- d1wvfa1 first appeared in SCOP 1.73
- d1wvfa1 appears in SCOPe 2.03
- d1wvfa1 appears in SCOPe 2.05
- d1wvfa1 appears in the current release, SCOPe 2.08
View in 3D
