| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
| Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (7 proteins) |
| Protein automated matches [254445] (2 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [254950] (2 PDB entries) |
| Domain d1wvfa2: 1wvf A:7-242 [121338] Other proteins in same PDB: d1wvfa1 automated match to d1wvfa2 complexed with acy, cl, fad, gol |
PDB Entry: 1wvf (more details), 1.3 Å
SCOPe Domain Sequences for d1wvfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvfa2 d.145.1.1 (A:7-242) automated matches {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp
Timeline for d1wvfa2: