Lineage for d1wvfa1 (1wvf A:243-521)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725809Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families) (S)
    duplication: contains two subdomains of this fold
  5. 725810Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)
  6. 725811Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
    the other subunit is a short-chain cytochrome c
  7. 725812Species Pseudomonas putida [TaxId:303] [55108] (4 PDB entries)
  8. 725813Domain d1wvfa1: 1wvf A:243-521 [121337]
    Other proteins in same PDB: d1wvfa2
    automatically matched to d1diia1
    complexed with acy, cl, fad, gol

Details for d1wvfa1

PDB Entry: 1wvf (more details), 1.3 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (A:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOP Domain Sequences for d1wvfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvfa1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

SCOP Domain Coordinates for d1wvfa1:

Click to download the PDB-style file with coordinates for d1wvfa1.
(The format of our PDB-style files is described here.)

Timeline for d1wvfa1:

Domains from same chain:
(mouse over for more information)
d1wvfa2