![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins) automatically mapped to Pfam PF02913 |
![]() | Protein automated matches [254446] (2 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [254951] (2 PDB entries) |
![]() | Domain d1wvfa1: 1wvf A:243-521 [121337] Other proteins in same PDB: d1wvfa2 automated match to d1wvfa1 complexed with acy, cl, fad, gol |
PDB Entry: 1wvf (more details), 1.3 Å
SCOPe Domain Sequences for d1wvfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvfa1 d.58.32.1 (A:243-521) automated matches {Pseudomonas putida [TaxId: 303]} pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr vaqsygpvkrklehaikravdpnnilapgrsgidlnndf
Timeline for d1wvfa1: