Lineage for d1u3ma_ (1u3m A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635625Protein Prion protein domain [54100] (14 species)
  7. 1635632Species Chicken (Gallus gallus) [TaxId:9031] [117766] (1 PDB entry)
    Uniprot P27177 132-248
  8. 1635633Domain d1u3ma_: 1u3m A: [113000]

Details for d1u3ma_

PDB Entry: 1u3m (more details)

PDB Description: nmr structure of the chicken prion protein fragment 128-242
PDB Compounds: (A:) prion-like protein

SCOPe Domain Sequences for d1u3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ma_ d.6.1.1 (A:) Prion protein domain {Chicken (Gallus gallus) [TaxId: 9031]}
gsvvgglggyamgrvmsgmnyhfdrpdeyrwwsensarypnrvyyrdysspvpqdvfvad
cfnitvteysigpaakkntseavaaanqtevemenkvvtkviremcvqqyreyrlas

SCOPe Domain Coordinates for d1u3ma_:

Click to download the PDB-style file with coordinates for d1u3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1u3ma_: