Lineage for d1u3ma_ (1u3m A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597694Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 597695Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 597696Family d.6.1.1: Prion-like [54099] (2 proteins)
  6. 597697Protein Prion protein domain [54100] (12 species)
  7. 597704Species Chicken (Gallus gallus) [TaxId:9031] [117766] (1 PDB entry)
  8. 597705Domain d1u3ma_: 1u3m A: [113000]

Details for d1u3ma_

PDB Entry: 1u3m (more details)

PDB Description: nmr structure of the chicken prion protein fragment 128-242

SCOP Domain Sequences for d1u3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ma_ d.6.1.1 (A:) Prion protein domain {Chicken (Gallus gallus)}
gsvvgglggyamgrvmsgmnyhfdrpdeyrwwsensarypnrvyyrdysspvpqdvfvad
cfnitvteysigpaakkntseavaaanqtevemenkvvtkviremcvqqyreyrlas

SCOP Domain Coordinates for d1u3ma_:

Click to download the PDB-style file with coordinates for d1u3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1u3ma_: