SCOPe 2.08: Domain d1u3ma1: 1u3m A:128-242

Lineage for d1u3ma1 (1u3m A:128-242)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein Prion protein domain [54100] (14 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [117766] (1 PDB entry)
   Uniprot P27177 132-248

8. Domain d1u3ma1: 1u3m A:128-242 [113000]
   Other proteins in same PDB: d1u3ma2

Details for d1u3ma1

PDB Entry: 1u3m

PDB Description: nmr structure of the chicken prion protein fragment 128-242

PDB Compounds: (A:) prion-like protein

SCOPe Domain Sequences for d1u3ma1:

Sequence; same for both SEQRES and ATOM records:

>d1u3ma1 d.6.1.1 (A:128-242) Prion protein domain {Chicken (Gallus gallus) [TaxId: 9031]}
vvgglggyamgrvmsgmnyhfdrpdeyrwwsensarypnrvyyrdysspvpqdvfvadcf
nitvteysigpaakkntseavaaanqtevemenkvvtkviremcvqqyreyrlas

Timeline for d1u3ma1:

• d1u3ma1 first appeared in SCOP 1.71, called d1u3ma_
  
• d1u3ma1 appears in SCOPe 2.07