![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein Prion protein domain [54100] (14 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [117766] (1 PDB entry) Uniprot P27177 132-248 |
![]() | Domain d1u3ma1: 1u3m A:128-242 [113000] Other proteins in same PDB: d1u3ma2 |
PDB Entry: 1u3m (more details)
SCOPe Domain Sequences for d1u3ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ma1 d.6.1.1 (A:128-242) Prion protein domain {Chicken (Gallus gallus) [TaxId: 9031]} vvgglggyamgrvmsgmnyhfdrpdeyrwwsensarypnrvyyrdysspvpqdvfvadcf nitvteysigpaakkntseavaaanqtevemenkvvtkviremcvqqyreyrlas
Timeline for d1u3ma1: