![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein Calcyclin (S100) [47479] (17 species) |
![]() | Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (8 PDB entries) Migration inhibitory factor-related protein 8 |
![]() | Domain d1mr8a_: 1mr8 A: [17186] complexed with ca |
PDB Entry: 1mr8 (more details), 1.9 Å
SCOPe Domain Sequences for d1mr8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mr8a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi ntdgavnfqeflilvikmgvaahkkshees
Timeline for d1mr8a_: