Lineage for d1mr8a_ (1mr8 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.2: S100 proteins [47478] (1 protein) Protein Calcyclin (S100) [47479] (9 species) 
Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (1 PDB entry) 
Domain d1mr8a_: 1mr8 A: [17186]
Details for d1mr8a_
PDB Entry: 1mr8 (more details), 1.9 Å
PDB Description: migration inhibitory factor-related protein 8 from human
SCOP Domain Sequences for d1mr8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mr8a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshees
SCOP Domain Coordinates for d1mr8a_:
Click to download the PDB-style file with coordinates for d1mr8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mr8a_:
- d1mr8a_ appears in SCOP 1.57
- d1mr8a_ appears in the current release, SCOPe 2.08
View in 3D
