PDB entry 1mr8

View 1mr8 on RCSB PDB site
Description: migration inhibitory factor-related protein 8 from human
Class: metal transport
Keywords: calcium-binding protein, mad, migration inhibitory factor_ related protein 8, s100 protein, metal transport
Deposited on 1999-04-13, released 2000-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: migration inhibitory factor-related protein 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mr8a_
  • Chain 'B':
    Compound: migration inhibitory factor-related protein 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mr8b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mr8A (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr8A (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshees
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mr8B (B:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr8B (B:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshees