Lineage for d1k6ya2 (1k6y A:56-210)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
Pfam PF00665Protein Retroviral integrase, catalytic domain [53108] (5 species) 
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries) 
Domain d1k6ya2: 1k6y A:56-210 [68240]
Other proteins in same PDB: d1k6ya1, d1k6yb1, d1k6yc1, d1k6yd1
complexed with k, po4, zn
Details for d1k6ya2
PDB Entry: 1k6y (more details), 2.4 Å
PDB Description: Crystal Structure of a Two-Domain Fragment of HIV-1 Integrase
PDB Compounds: (A:) integraseSCOPe Domain Sequences for d1k6ya2:
Sequence, based on SEQRES records: (download)
>d1k6ya2 c.55.3.2 (A:56-210) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiqt
Sequence, based on observed residues (ATOM records): (download)
>d1k6ya2 c.55.3.2 (A:56-210) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgviesmnkelkkiigqvrdqaehlktavqmavfihn
kkrkggiggysagerivdiiatdiqt
SCOPe Domain Coordinates for d1k6ya2:
Click to download the PDB-style file with coordinates for d1k6ya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k6ya2:
- d1k6ya2 first appeared in SCOP 1.59
- d1k6ya2 appears in SCOPe 2.07
View in 3D
