SCOPe 2.08: Domain d1k6yb1: 1k6y B:1-46

Lineage for d1k6yb1 (1k6y B:1-46)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families)

5. Family a.4.10.1: HIV/SIV integrase, N-terminal Zn binding domain [46920] (2 proteins)
   Zn-binding site is near the C-terminus
   Pfam PF02022

6. Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries)

8. Domain d1k6yb1: 1k6y B:1-46 [68241]
   Other proteins in same PDB: d1k6ya2, d1k6yb2, d1k6yc2, d1k6yd2
   complexed with k, po4, zn

Details for d1k6yb1

PDB Entry: 1k6y, 2.4 Å

PDB Description: Crystal Structure of a Two-Domain Fragment of HIV-1 Integrase

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d1k6yb1:

Sequence; same for both SEQRES and ATOM records:

>d1k6yb1 a.4.10.1 (B:1-46) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlk

Timeline for d1k6yb1:

• d1k6yb1 first appeared in SCOP 1.59
  
• d1k6yb1 appears in SCOPe 2.07